Select your products and services :
Select your country :
Americas
Europe
Asia and South Pacific
Middle East and Africa

Update your choices | BU : Life Science | Country : USA

Ion Channel Peptides

Catalog Go™ peptides

DescriptionSize Reference USD Qty  
GALA, Pore-Forming Peptide - 1 mg1 mg AS-62311 237.00Add to cart
Ryanodine receptor 1 (RyR1) (3614-3643); Calmodulin Binding Peptide (CaMBP) - 1 mg1 mg AS-64606 220.00Add to cart
Reference Name Sequence MW (Da)
AS-62311 GALA, Pore-Forming Peptide WEAALAEALAEALAEHLAEALAEALEALAA 3032,4
AS-64606 RyR1 (3614-3643); Calmodulin Binding Peptide (CaMBP) KSKKAVWHKLLSKQRRRAVVACFRMTPLYN 3616,4
Reference Name Description
AS-62311 GALA, Pore-Forming Peptide GALA is a 30 amino acid synthetic peptide with a glutamic acid-alanine-leucine-alanine (EALA) repeat. It also contains a histidine and tryptophan residue as spectroscopic probes. This peptide was designed to explore how viral fusion protein sequences interact with membranes. It was used to study the importance of the helix length, hydrophobicity, and hydrophobic moment on the formation, structure, and function of ion channels. The membrane-interacting properties of GALA have been extensively documented. Investigations with analogs of cytotoxic peptides clarify the importance of peptide charge and the role of particular amino acids or arrays of amino acids in the conformation, membrane-binding affinity, and pore-forming abilities of these toxins.
AS-64606 RyR1 (3614-3643); Calmodulin Binding Peptide (CaMBP) This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
The EGT Ordering System (EOS) is the simplest and easiest way to place your orders including:

 
All oligonucleotides
All Kits & Reagents (including Catalogue Antibodies & Peptides, Real-Time qPCR Mixes, Taq Polymerases, Sensolyte® Assays...)

Please use your Login or Register Now to directly access your customized EOS interface.



You can still place orders by:
orders.anaspec@egt-biotech.com
  When placing your order, please include the following information:
  Contact person purchase order number
  delivery address product description and reference number
  invoice address quotation number
  telephone number  

Related products


We use cookies to ensure the best experience on our website. By continuing to use this website, you consent to our cookie policy.