Select your products and services :
Select your country :
Americas
Europe
Asia and South Pacific
Middle East and Africa

Update your choices | BU : Life Science | Country : USA

Ovalbumin Peptides

Catalog Go™ peptides

OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).


DescriptionSize Reference USD Qty  
OVA (241-270) - 1 mg1 mg AS-64525 209.00Add to cart
OVA (257-264) - 1 mg1 mg AS-60193-1 49.00Add to cart
OVA (257-264) - 5 mg5 mg AS-60193-5 198.00Add to cart
OVA (257-264), amide - 5 mg5 mg AS-62572-5 313.00Add to cart
OVA (257-264), FAM labeled - 1 mg1 mg AS-64231 225.00Add to cart
OVA (257-264), scrambled - 1 mg1 mg AS-64413 99.00Add to cart
OVA (323-339) - 1 mg1 mg AS-27024 110.00Add to cart
OVA (323-339) - 5 mg5 mg AS-27025 435.00Add to cart
OVA (323-339), amide - 1 mg1 mg AS-62571-1 99.00Add to cart
OVA (323-339), amide - 5 mg5 mg AS-62571-5 396.00Add to cart
OVA (323-339), biotin-labeled - 1 mg1 mg AS-64767 165.00Add to cart
OVA (323-339), FITC-labeled - 1 mg1 mg AS-64766 247.00Add to cart
OVA (323-339), TAMRA labeled - 1 mg1 mg AS-64232 275.00Add to cart
OVA (329-337) - 1 mg1 mg AS-64777 77.00Add to cart
OVA-A2 Peptide, SAINFEKL, OVA (257-264) Variant - 1 mg1 mg AS-64383 99.00Add to cart
OVA-G4 Peptide, SIIGFEKL, OVA (257-264) Variant - 1 mg1 mg AS-64384 99.00Add to cart
OVA-Q4 Peptide, pQ4, SIIQFEKL, OVA (257-264) Variant   - 1 mg1 mg AS-64402 99.00Add to cart
OVA-Q4H7 Peptide, pQ4H7, SIIQFEHL, OVA (257-264) Variant   - 1 mg1 mg AS-64405 99.00Add to cart
OVA-T4 Peptide, SIITFEKL, pT4, OVA (257-264) Variant   - 1 mg1 mg AS-64403 99.00Add to cart
Reference Name Sequence MM (kDa)
AS-65066 Asp-OVA (257-264); OVA Antagonist SIINFEDL 950,1
AS-62194 E1, (E257) EIINFEKL 1005,2
AS-64407 Leu-OVA (257-264), LSIINFEKL LSIINFEKL 1076,3
AS-64230 LLO190 NEKYAQAYPNVS 1383,5
AS-64408 Lys-OVA (257-264), KSIINFEKL KSIINFEKL 1091,3
AS-62573 MSL8, [Met256]-OVA (257-264) MSIINFEKL 1094,4
AS-64410 N6-SIINKEFL, OVA (251–264), GLEQLESIINFEKL  GLEQLESIINFEKL 1632,9
AS-64411 N9-SIINKEFL, OVA (248–264), EVSGLEQLESIINFEKL EVSGLEQLESIINFEKL 1948,2
AS-64525 OVA (241-270) SMLVLLPDEVSGLEQLESIINFEKLTEWTS 3421,9
AS-60193 OVA (257-264) SIINFEKL 963,2
AS-60793 OVA (257-264) Variant E1 Pyr-IINFEKL 1005,8
AS-62572 OVA (257-264), amide SIINFEKL-NH2 962,2
AS-64231 OVA (257-264), FAM labeled 5-FAM-SIINFEKL-NH2 1320,5
AS-64413 OVA (257-264), scrambled, FILKSINE FILKSINE 963,2
AS-64792 OVA (257-280) SIINFEKLTEWTSSNVMEERKIKV 2882,3
AS-64796 OVA (265-280) TEWTSSNVMEERKIKV 1937,2
AS-27024/27025 OVA (323-339) ISQAVHAAHAEINEAGR 1773,9
AS-62571 OVA (323-339), amide ISQAVHAAHAEINEAGR-NH2 1773
AS-64767 OVA (323-339), biotin-labeled Biotin-ISQAVHAAHAEINEAGR 2000,2
AS-64233 OVA (323-339), FAM labeled 5-FAM-ISQAVHAAHAEINEAGR 2132,2
AS-64766 OVA (323-339), FITC-labeled FITC-LC-ISQAVHAAHAEINEAGR 2276,5
AS-64232 OVA (323-339), TAMRA labeled 5-TAMRA-ISQAVHAAHAEINEAGR 2186,4
AS-62577 OVA (327-333) VHAAHAE 733,8
AS-64777 OVA (329-337) AAHAEINEA 925
AS-64383 OVA-A2 Peptide, SAINFEKL, OVA (257-264) Variant SAINFEKL 921,1
AS-60194 OVA-BIP Hybrid Peptide SIINFEKLGSGHWDFAWPW 2290,6
AS-64384 OVA-G4 Peptide, SIIGFEKL, OVA (257-264) Variant SIIGFEKL 906,1
AS-64401 OVA-K4 Peptide, SIIKFEKL, OVA (257-264) Variant SIIKFEKL 977,2
AS-64402 OVA-Q4 Peptide, pQ4, SIIQFEKL, OVA (257-264) Variant   SIIQFEHL 977,2
AS-64405 OVA-Q4H7 Peptide, pQ4H7, SIIQFEHL, OVA (257-264) Variant   SIIQFEHL 986,1
AS-64404 OVA-Q7 Peptide, pQ7, SIINFEQL, OVA (257-264) Variant   SIINFEQL 963,1
AS-64382 OVA-R4 Peptide, SIIRFEKL, OVA (257-264) Variant SIIRFEKL 1005,2
AS-64403 OVA-T4 Peptide, SIITFEKL, pT4, OVA (257-264) Variant   SIITFEKL 950,2
AS-64788 OVA-Y5 Peptide, OVA (257-264) Variant SIINYEKL 979,2
AS-64409 Tyr-OVA (257-264), YSIINFEKL YSIINFEKL 1126,3
AS-64406 V-OVA Peptide, RGYNYEKL, OVA (257-264) Variant RGYNYEKL 1042,2
Reference Name Description
AS-65066 Asp-OVA (257-264); OVA Antagonist This peptide is OVA (257-264) with substitution of Lys263 for an aspartic acid residue. This is the in vitro antagonist of OVA-specific CD8 T cells.  Sequential administration of OVA and OVA antagonist peptides results in original antigenic sin (OAS) in which immune responses elicited by the second peptide only target the original peptide. Simultaneous administration of OVA and OVA antagonist do not produce immune interference and is important in the application of multi-mutant vaccines.
AS-62194 E1, (E257) This peptide is an antagonist variant of OVA (257-264). It induces positive selection on the beta 2M (-/-), and negative selection on beta 2M (+/-) background. This peptide was used to study the ability of the wild-type or mutant TCRs to transduce signals leading to positive or negative selection, and was utilized in several thymocyte development studies. E1 presentation leads to Egr-1 induction and ERK phosphorylation.
AS-64407 Leu-OVA (257-264), LSIINFEKL This is OVA peptide (257-264), SIINFEKL, with a Leu at the C-terminus.
AS-64230 LLO190 This peptide is a major histocompatibility complex class II (MHC-II)-restricted peptide, LLO190 (NEKYAQAYPNVS), from the listeriolysin O protein of Listeria monocytogenes, which generates an LLO190-specific Th response. This peptide subsequently challenge  recombinant L. monocytogenes expressing the MHC-I-restricted epitope of ovalbumin (Ova257, SIINFEKL).
AS-64408 Lys-OVA (257-264), KSIINFEKL KSIINFEKL is an analogue of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL.
AS-62573 MSL8, [Met256]-OVA (257-264)  
AS-64410 N6-SIINKEFL, OVA (251–264), GLEQLESIINFEKL  This is an ovalbumin (OVA) peptide that contains 6 residues of natural N-terminal flanking residues.
AS-64411 N9-SIINKEFL, OVA (248–264), EVSGLEQLESIINFEKL This is an ovalbumin (OVA) peptide that contains 9 residues of natural N-terminal flanking residues.
AS-64525 OVA (241-270) This peptide is OVA peptide residues 241 to 270.
AS-60193 OVA (257-264) This is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class I MHC molecule, H-2Kb.
AS-60793 OVA (257-264) Variant E1 An antagonist variant of OVA (257-264). It induces positive selection on the beta 2M (-/-), and negative selection on beta 2M (+/-) background.
AS-62572 OVA (257-264), amide This octameric peptide is amino acids 257 to 264 amidated fragment of ovalbumin (OVA), a class I (Kb)-restricted peptide epitope of OVA, presented by the class I MHC molecule, H-2Kb.
AS-64231 OVA (257-264), FAM labeled This is a class I (Kb)-restricted peptide epitope of OVA. It is fluorescent (5-FAM)-labeled, Abs/Em=494/521 nm.
AS-64413 OVA (257-264), scrambled, FILKSINE FILKSINE is the scrambled version of ovalbumin (OVA) peptide (257-264), SIINFEKL.
AS-64792 OVA (257-280) This sequence is OVA peptide residues 257 to 280, consisting of the class I (Kb)-restricted (amino acids 257–264) epitope and the class II (I-Ab)-restricted (amino acids 265-280) epitope of ovalbumin. These two regions combined may induce a strong CTL response.
AS-64796 OVA (265-280) This sequence is OVA peptide residues 265 to 280, consisting of the class II (I-Ab)-restricted epitope of ovalbumin which binds to CD4+ T cells to initiate the development of a CTL response via a class II MHC-dependent pathway.
AS-27024/27025 OVA (323-339) An H-2b-restricted OVA class II epitope.
AS-62571 OVA (323-339), amide This peptide is amino acids 323 to 339 amidated fragment of ovalbumin (OVA). This peptide is recognized by many T cells because it contains multiple T cell epitopes. This OVA fragment contains a nested set of CD4+ T cell epitopes. OVA 323 to 339 can be presented by I-Ad in at least three binding registers. The residues 327 to 333 are critical for peptide binding to I-Ad
AS-64767 OVA (323-339), biotin-labeled This is an N-terminal biotin-labeled OVA Peptide, amino acids 323 to 339. This peptide is an H-2b-restricted OVA class II epitope.
AS-64233 OVA (323-339), FAM labeled This is a class II (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class II MHC molecule, H-2Kb. It is fluorescent (5-FAM)-labeled, Abs/Em=494/521 nm.
AS-64766 OVA (323-339), FITC-labeled This fluorescent (FITC)-labeled OVA (323 - 339) Peptide is an H-2b-restricted OVA class II epitope (Abs/Em = 493/522 nm).
AS-64232 OVA (323-339), TAMRA labeled This is a class II (Kb)-restricted peptide epitope of OVA, an octameric peptide from ovalbumin presented by the class II MHC molecule, H-2Kb. It is fluorescently labeled with 5-TAMRA, Abs/Em = 541/565 nm.
AS-62577 OVA (327-333) This peptide is amino acids 327 to 333 fragment of ovalbumin (OVA). This sequence is a core region of ovalbumin peptide critical for binding to I-Ad . It shares sequence homology with other I-Ad  binding peptides derived from other antigenic systems. This fragment is the primary TCR contact residue.
AS-64777 OVA (329-337) This sequence is OVA (ovalbumin) peptide residues 257 to 280, also known as OT-II (OVA-specific T-cell receptor) peptide, the core H2b-restricted class II MHC epitope.
AS-64383 OVA-A2 Peptide, SAINFEKL, OVA (257-264) Variant A2 peptide (SAINFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL.
AS-60194 OVA-BIP Hybrid Peptide This is a hybrid peptide containing OVA-Bip motif that binds to the Heat Shock Proteins (HSP 70) through the Bip sequence. Heat shock proteins derived from tumors or virally infected cells can stimulate antigen-specific CD8+ T cell responses in-vitro and in-vivo. The binding motif of HSP 70 consists of a hydrophobic core of four to five amino acids and two flanking regions enriched in basic residues.
AS-64384 OVA-G4 Peptide, SIIGFEKL, OVA (257-264) Variant G4 peptide (SIIGFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL.
AS-64401 OVA-K4 Peptide, SIIKFEKL, OVA (257-264) Variant K4 peptide (SIIKFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL.
AS-64402 OVA-Q4 Peptide, pQ4, SIIQFEKL, OVA (257-264) Variant   Q4 Peptide (SIIQFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL.
AS-64405 OVA-Q4H7 Peptide, pQ4H7, SIIQFEHL, OVA (257-264) Variant   Q4H7 Peptide (SIIQFEHL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL.
AS-64404 OVA-Q7 Peptide, pQ7, SIINFEQL, OVA (257-264) Variant   Q7 Peptide (SIINFEQL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL.
AS-64382 OVA-R4 Peptide, SIIRFEKL, OVA (257-264) Variant R4 peptide (SIIRFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL.
AS-64403 OVA-T4 Peptide, SIITFEKL, pT4, OVA (257-264) Variant   T4 peptide (SIITFEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL.
AS-64788 OVA-Y5 Peptide, OVA (257-264) Variant Y5 peptide (SIINYEKL) is OVA amino acids 257 to 264 derived from chicken ovalbumin in which Phe261 is substituted with Tyr261.  The low-affinity property of Y5 enables it to bind to major histocompatibility complex class 1 (MHC 1).  Y5 is a tumor antigen
AS-64409 Tyr-OVA (257-264), YSIINFEKL This is ovalbumin (OVA) peptide (257-264), SIINFEKL with a Tyr at the C-terminus.
AS-64406 V-OVA Peptide, RGYNYEKL, OVA (257-264) Variant V-OVA peptide (RGYNYEKL) is a variant of the agonist ovalbumin (OVA) peptide (257-264), SIINFEKL.
The EGT Ordering System (EOS) is the simplest and easiest way to place your orders including:

 
All oligonucleotides
All Kits & Reagents (including Catalogue Antibodies & Peptides, Real-Time qPCR Mixes, Taq Polymerases, Sensolyte® Assays...)

Please use your Login or Register Now to directly access your customized EOS interface.



You can still place orders by:
orders.anaspec@egt-biotech.com
  When placing your order, please include the following information:
  Contact person purchase order number
  delivery address product description and reference number
  invoice address quotation number
  telephone number  

Related products


We use cookies to ensure the best experience on our website. By continuing to use this website, you consent to our cookie policy.