Select your products and services :
Select your country :
Americas
Europe
Asia and South Pacific
Middle East and Africa

Update your choices | BU : Life Science | Country : USA

Tag Peptides

Catalog Go™ peptides

DescriptionSize Reference USD Qty  
DYKDDDDK tag, Flag tag - 5 mg5 mg AS-60738 193.00Add to cart
Glu-Glu epitope Tag - 5 mg5 mg AS-62189 143.00Add to cart
HA 12CA5 Epitope Tag - 1 mg1 mg AS-62229 115.00Add to cart
HA Tag - 1 mg1 mg AS-21156 49.00Add to cart
HA Tag - 5 mg5 mg AS-21158 193.00Add to cart
HA Tag 3X - 1 mg1 mg AS-63764 347.00Add to cart
His Tag - 1 mg1 mg AS-24420 93.00Add to cart
His Tag - 5 mg5 mg AS-24421 242.00Add to cart
Rhodopsin Epitope Tag - 5 mg5 mg AS-62190 193.00Add to cart
V5 Epitope Tag - 1 mg1 mg AS-61176 83.00Add to cart
Reference Name Sequence MM (kDa)
AS-63764 3 x Hemagglutinin (HA) Tag MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE 4372,7
AS-60738 DYKDDDDK DYKDDDDK 1013
AS-62189 Glu-Glu epitope Tag EYMPME 798,9
AS-62229 HA 12CA5 Epitope CYPYDVPDYA 1205,3
AS-21156/21158 HA peptide YPYDVPDYA 1102,2
AS-24420/24421 Hexa His HHHHHH 840,9
AS-62190 Rhodopsin Epitope Tag TETSQVAPA 903
AS-61176 V5 Epitope Tag GKPIPNPLLGLDST 1421,7
Reference Name Sequence MM (kDa)
AS-63764 3 x Hemagglutinin (HA) Tag MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE 4372,7
AS-60738 DYKDDDDK DYKDDDDK 1013
AS-62189 Glu-Glu epitope Tag EYMPME 798,9
AS-62229 HA 12CA5 Epitope CYPYDVPDYA 1205,3
AS-21156/21158 HA peptide YPYDVPDYA 1102,2
AS-24420/24421 Hexa His HHHHHH 840,9
AS-62190 Rhodopsin Epitope Tag TETSQVAPA 903
AS-61176 V5 Epitope Tag GKPIPNPLLGLDST 1421,7
The EGT Ordering System (EOS) is the simplest and easiest way to place your orders including:

 
All oligonucleotides
All Kits & Reagents (including Catalogue Antibodies & Peptides, Real-Time qPCR Mixes, Taq Polymerases, Sensolyte® Assays...)

Please use your Login or Register Now to directly access your customized EOS interface.



You can still place orders by:
orders.anaspec@egt-biotech.com
  When placing your order, please include the following information:
  Contact person purchase order number
  delivery address product description and reference number
  invoice address quotation number
  telephone number  

We use cookies to ensure the best experience on our website. By continuing to use this website, you consent to our cookie policy.