Select your products and services :
Select your country :
Americas
Europe
Asia and South Pacific
Middle East and Africa

Update your choices | BU : Life Science | Country : USA

Tag Peptides

Catalog Go™ peptides

DescriptionSize Reference USD Qty  
DYKDDDDK tag, Flag tag - 5 mg5 mg AS-60738 193.00Add to cart
Glu-Glu epitope Tag - 5 mg5 mg AS-62189 143.00Add to cart
HA 12CA5 Epitope Tag - 1 mg1 mg AS-62229 115.00Add to cart
HA Tag - 1 mg1 mg AS-21156 49.00Add to cart
HA Tag - 5 mg5 mg AS-21158 193.00Add to cart
HA Tag 3X - 1 mg1 mg AS-63764 347.00Add to cart
His Tag - 1 mg1 mg AS-24420 93.00Add to cart
His Tag - 5 mg5 mg AS-24421 242.00Add to cart
Rhodopsin Epitope Tag - 5 mg5 mg AS-62190 193.00Add to cart
V5 Epitope Tag - 1 mg1 mg AS-61176 83.00Add to cart
Reference Name Sequence MM (kDa)
AS-63764 3 x Hemagglutinin (HA) Tag MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE 4372,7
AS-60738 DYKDDDDK DYKDDDDK 1013
AS-62189 Glu-Glu epitope Tag EYMPME 798,9
AS-62229 HA 12CA5 Epitope CYPYDVPDYA 1205,3
AS-21156/21158 HA peptide YPYDVPDYA 1102,2
AS-24420/24421 Hexa His HHHHHH 840,9
AS-62190 Rhodopsin Epitope Tag TETSQVAPA 903
AS-61176 V5 Epitope Tag GKPIPNPLLGLDST 1421,7
Reference Name Sequence MM (kDa)
AS-63764 3 x Hemagglutinin (HA) Tag MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE 4372,7
AS-60738 DYKDDDDK DYKDDDDK 1013
AS-62189 Glu-Glu epitope Tag EYMPME 798,9
AS-62229 HA 12CA5 Epitope CYPYDVPDYA 1205,3
AS-21156/21158 HA peptide YPYDVPDYA 1102,2
AS-24420/24421 Hexa His HHHHHH 840,9
AS-62190 Rhodopsin Epitope Tag TETSQVAPA 903
AS-61176 V5 Epitope Tag GKPIPNPLLGLDST 1421,7

On our webshop:

Eurogentec webshop is the simplest and easiest way to place your orders including:

All oligonucleotides
All Kits & Reagents (including Catalogue Antibodies & Peptides, Real-Time qPCR Mixes, Taq Polymerases, Sensolyte® Assays...)

Please use your Login or Register Now to directly access your customized EOS interface.


By email:

order@eurogentec.com

  When placing your order, please include the following information:
  client account number telephone number
  contract number / quotation number product description and reference number
  contact person quantity
  delivery address purchase order number
  invoice address    


By contacting your sales representative:

Consult our sales representative list


By contacting our distributors:

Check our complete distributor list

We use cookies to ensure the best experience on our website. By continuing to use this website, you consent to our cookie policy.